The Perl Toolchain Summit needs more sponsors. If your company depends on Perl, please support this very important event.
LOCUS       DQ018368                 523 bp    DNA     linear   PLN 23-MAY-2005
DEFINITION  (Populus tomentosa x P. bolleana) x P. tomentosa var. truncata
            BS-LRR type disease resistance protein (RGA6) gene, partial cds.
ACCESSION   DQ018368
VERSION     DQ018368.1  GI:66271013
KEYWORDS    .
SOURCE      (Populus tomentosa x P. bolleana) x P. tomentosa var. truncata
  ORGANISM  (Populus tomentosa x P. bolleana) x P. tomentosa var. truncata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
            rosids; eurosids I; Malpighiales; Salicaceae; Saliceae; Populus.
REFERENCE   1  (bases 1 to 523)
  AUTHORS   Zhang,Q., Lin,S.Z., Lin,Y.Z., Zhou,Y.L., Zhang,Z.Y., Zheng,H.Q.,
            Chen,J.B., Wang,Z.L., Qiao,M.J., Wang,X. and Zhu,B.Q.
  TITLE     Characterization and cloning of disease resistance gene from poplar
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 523)
  AUTHORS   Zhang,Q., Lin,S.Z., Lin,Y.Z., Zhou,Y.L. and Zhang,Z.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2005) Key Laboratory for Genetics and Breeding in
            Forest Trees and Ornamental Plants, MOE, Beijing Forestry
            University, Box 118, Qinghuadong Road, Beijing 100083, P.R.China
FEATURES             Location/Qualifiers
     source          1..523
                     /organism="(Populus tomentosa x P. bolleana) x P.
                     tomentosa var. truncata"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:328805"
     gene            <1..>523
                     /gene="RGA6"
     mRNA            <1..>523
                     /gene="RGA6"
                     /product="BS-LRR type disease resistance protein"
     CDS             <1..>523
                     /gene="RGA6"
                     /codon_start=1
                     /product="BS-LRR type disease resistance protein"
                     /protein_id="AAY43785.1"
                     /db_xref="GI:66271014"
                     /translation="GMGGIGKTTVARVVYDRIRWQFEGSCFLANVREDLAKKGGQRRL
                     QEQLLSEILMERANICDSSRGIEMIKRRLQRKKILVVLDDVDDRKQLESLAAESKWFG
                     PESRIIITSRDKQVLTRNGVTRIYEAEKLNDDDALMLFSQKAFKKDQPVEDFVKLSKQ
                     VVGYANGPSTCPQS"
ORIGIN      
        1 gggatggggg gtataggtaa gactactgtt gcaagggtag tatatgatag gattcgttgg
       61 caatttgaag gtagctgttt cttagcaaat gtcagagaag atcttgctaa gaaaggtgga
      121 caacgccgtt tacaggagca acttctttct gaaatcttaa tggaacgtgc taatatatgt
      181 gattcttcta gaggaattga aatgataaag cggaggttac aacgtaaaaa gattcttgtt
      241 gttcttgatg atgtagatga ccgtaaacaa ctagaatccc tggctgcgga gagtaaatgg
      301 tttggtccag agagtagaat tatcataaca agcagagata aacaagtgtt gactagaaat
      361 ggtgttacta gaatttatga ggctgagaaa ttgaatgatg atgatgctct tatgttgttt
      421 agccagaaag ctttcaaaaa agaccaacct gttgaggatt ttgtgaaact atccaagcaa
      481 gttgtgggtt atgctaatgg gccttccact tgccctcaaa gtc
//