BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038724|dbj|BAB12759.1| DNA-binding protein hu-alpha
[Buchnera sp. APS]
(92 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.310 0.127 0.323
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 99
Number of Sequences: 1
Number of extensions: 4
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 92
length of database: 607
effective HSP length: 24
effective length of query: 68
effective length of database: 583
effective search space: 39644
effective search space used: 39644
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 42 (21.8 bits)
S2: 156 (65.2 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038744|dbj|BAB12779.1| DNA primase [Buchnera sp. APS]
(577 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
Score E
Sequences producing significant alignments: (bits)
Value
gi|12045104|ref|NP_072915.1| DNA primase (dnaE) [Mycoplasma gen... 125 7e-33
>gi|12045104|ref|NP_072915.1| DNA primase (dnaE) [Mycoplasma
genitalium]
Length = 607
Score = 125 bits (310), Expect = 7e-33
Identities = 118/461 (25%), Positives = 222/461 (47%), Gaps = 57/461 (12%)
Query: 10 ITELLSRTNIIELI-NTRLELKKYGKNYQTNCPFHHDKTPSFTVSNEKQFYYCFGCNAHG 68
+ ELL + I E+I + ++++ G + CPFH DK PS ++S+ K + C+ CNA G
Sbjct: 8 LDELLKQIKITEIIQHYGVKIQTKGNSLLALCPFHDDKNPSMSISSSKNIFKCWACNAAG 67
Query: 69 NAIDFLIQYEHLSFIESIEELALIHGVKIPFENTVQNSIYVKKQKLYLLMEKICKLY--- 125
N I F+ +++ L + ++++ I G+K+ N+ + KQK Y + Y
Sbjct: 68 NGIAFIQKHDQLDWKTALKKAIEICGIKLENWNSNLLTKVDPKQKRYWEINNALITYYQT 127
Query: 126 --KKNINVTHLANKYLARRGINQNMIDFFLIGFSSLKWNEFYKKINISKEFEQELLINNI 183
K+ N + N + +R +N+ +I+ F +G + +++ + + E+ IN
Sbjct: 128 RLKRETNPNGM-NYLVEKRKLNKTLIEQFQLGLAFHNEDKY-----LCESMERYPFINPK 181
Query: 184 I---------ATDKNGY-IYD------RFQGRIIFPIQDNHGRIIGFGGRSLNDMSP-KY 226
I T++ G +D FQ +I+ PI D +G +GF RS+++++ KY
Sbjct: 182 IKPSELYLFSKTNQQGLGFFDFNTKKATFQNQIMIPIHDFNGNPVGFSARSVDNINKLKY 241
Query: 227 LNSPETDIFYKRKQIYGLYQVIKKCSKPVYLLVVEGYIDVITLTQYNIDYAVSILGTSTT 286
NS + + F K + ++ +++ K ++ L +VEGY DV TLT + AV+++G +
Sbjct: 242 KNSADHEFFKKGELLFNFHRLNKNLNQ---LFIVEGYFDVFTLTNSKFE-AVALMGLALN 297
Query: 287 TEHIQLL---FKNTDIIICCYDGDDAGKNAAWKTLKKALPYISDKKTLKFILL--PNQED 341
I+ + FK ++ D D +G+NA + ++K +++ + I+ N +D
Sbjct: 298 DVQIKAIKAHFKELQTLVLALDNDASGQNAVFSLIEK----LNNNNFIVEIVQWEHNYKD 353
Query: 342 PDTIIRKEGREKF----QKRIDNAITMSKFFFKNILKNINLSSDDDKFHLSVHALPLINT 397
D + +G E+ KR + + FF K L +++ F L T
Sbjct: 354 WDELYLNKGSEQVILQANKRQNLIEYLVSFFKKQQLDQRVITNKIIAF------LTKNQT 407
Query: 398 ISSD-TIRIYLRQILARMIGILDDNQFEKFLYEKETKNTQK 437
I +D + I+L + L +++ D EK LYE K+ +K
Sbjct: 408 ILNDHSFLIFLIKNLVKLLEYSD----EKTLYETVLKHKEK 444
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.322 0.140 0.406
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 932
Number of Sequences: 1
Number of extensions: 63
Number of successful extensions: 4
Number of sequences better than 1.0e-15: 1
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 577
length of database: 607
effective HSP length: 24
effective length of query: 553
effective length of database: 583
effective search space: 322399
effective search space used: 322399
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.9 bits)
S2: 164 (68.3 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038814|dbj|BAB12849.1| integration host factor
alpha-subunit [Buchnera sp. APS]
(102 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.321 0.138 0.372
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 101
Number of Sequences: 1
Number of extensions: 4
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 102
length of database: 607
effective HSP length: 21
effective length of query: 81
effective length of database: 586
effective search space: 47466
effective search space used: 47466
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.9 bits)
S2: 157 (65.6 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038947|dbj|BAB12982.1| DNA-binding protein H-ns [Buchnera
sp. APS]
(135 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.319 0.137 0.390
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 132
Number of Sequences: 1
Number of extensions: 3
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 135
length of database: 607
effective HSP length: 23
effective length of query: 112
effective length of database: 584
effective search space: 65408
effective search space used: 65408
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 158 (66.0 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038982|dbj|BAB13017.1| integration host factor
beta-subunit [Buchnera sp. APS]
(94 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.319 0.136 0.372
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 114
Number of Sequences: 1
Number of extensions: 6
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 94
length of database: 607
effective HSP length: 21
effective length of query: 73
effective length of database: 586
effective search space: 42778
effective search space used: 42778
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 157 (65.6 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10038996|dbj|BAB13030.1| cold shock-like protein cspC
[Buchnera sp. APS]
(69 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.316 0.136 0.399
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 100
Number of Sequences: 1
Number of extensions: 5
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 69
length of database: 607
effective HSP length: 20
effective length of query: 49
effective length of database: 587
effective search space: 28763
effective search space used: 28763
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.6 bits)
S2: 155 (64.8 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10039073|dbj|BAB13107.1| carbon storage regulator [Buchnera
sp. APS]
(57 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.318 0.138 0.362
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64
Number of Sequences: 1
Number of extensions: 2
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 57
length of database: 607
effective HSP length: 22
effective length of query: 35
effective length of database: 585
effective search space: 20475
effective search space used: 20475
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 154 (64.4 bits)
BLASTP 2.1.2 [Oct-19-2000]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|10039151|dbj|BAB13185.1| cold shock-like protein cspE
[Buchnera sp. APS]
(69 letters)
Database: mycge
1 sequences; 607 total letters
Searchingdone
***** No hits found ******
Database: mycge
Posted date: May 8, 2001 3:12 PM
Number of letters in database: 607
Number of sequences in database: 1
Lambda K H
0.313 0.132 0.375
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 80
Number of Sequences: 1
Number of extensions: 2
Number of successful extensions: 0
Number of sequences better than 1.0e-15: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 69
length of database: 607
effective HSP length: 21
effective length of query: 48
effective length of database: 586
effective search space: 28128
effective search space used: 28128
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 42 (21.9 bits)
S2: 155 (64.8 bits)