InSilicoSpectro::InSilico::RetentionTimer - A base class for implementing a peptide retention time predictor
use InSilicoSpectro::InSilico::RetentionTimer; # create a retention time predictor my $rt = InSilicoSpectro::InSilico::RetentionTimer->new; # predict retention time for a peptide $rt->predict( peptide=>'ACFGDMKWVTFISLLRPLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE' ); # calibrate the predictor $rt->calibrate( data=>{calseqs=>\@calseqs,caltimes=>\@caltimes,calmodifs=>\@calmodifs},calibrator=>$ec );
InSilicoSpectro::InSilico::RetentionTimer is a base class for predictors of peptides retention time in HPLC. It gives also a method for calibration of the predictor.
This function counts the number of ocurrences of each amino acid in a given sequence and returns a reference to an array with the count sorted by the one-letter symbol: ACDEFGHIKLMNPQRSTVWY.
my $count = count_aa( 'AAK' ); print "Found $count[0] Alanines and $count[1] Cysteines\n";
$h contains a hash with parameters.
Predict the retention time.
Calibrate the predictor.
Save current calibrator.
Retrieve a previously saved calibrator.
Set an instance parameter.
Get an instance parameter.
InSilicoSpectro::InSilico::RetentionTime::Hodges
InSilicoSpectro::InSilico::RetentionTime::Petritis
InSilicoSpectro::InSilico::ExpCalibrator
InSilicoSpectro::InSilico::IsoelPoint
Copyright (C) 2004-2005 Geneva Bioinformatics www.genebio.com
This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version.
This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details.
You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
Pablo Carbonell, Alexandre Masselot, www.genebio.com
To install InSilicoSpectro, copy and paste the appropriate command in to your terminal.
cpanm
cpanm InSilicoSpectro
CPAN shell
perl -MCPAN -e shell install InSilicoSpectro
For more information on module installation, please visit the detailed CPAN module installation guide.